Lineage for d5to2b_ (5to2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806221Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)
  8. 2806369Domain d5to2b_: 5to2 B: [334274]
    Other proteins in same PDB: d5to2d_
    automated match to d3ry1b_
    complexed with peg

Details for d5to2b_

PDB Entry: 5to2 (more details), 1.65 Å

PDB Description: crystal structure of streptavidin with one wild type subunit and three mutated subunits (n23a/s27d/s45a)
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d5to2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5to2b_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
agitgtwyaqlgdtfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
p

SCOPe Domain Coordinates for d5to2b_:

Click to download the PDB-style file with coordinates for d5to2b_.
(The format of our PDB-style files is described here.)

Timeline for d5to2b_: