Lineage for d5ucwb_ (5ucw B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331534Protein automated matches [190068] (8 species)
    not a true protein
  7. 2331535Species Bacillus megaterium [TaxId:1404] [188479] (6 PDB entries)
  8. 2331539Domain d5ucwb_: 5ucw B: [334272]
    automated match to d2uwha_
    complexed with hem

Details for d5ucwb_

PDB Entry: 5ucw (more details), 1.7 Å

PDB Description: cytochrome p411 p-4 a82l a78v f263l amination catalyst
PDB Compounds: (B:) NADPH-cytochrome P450 reductase 102A1V3

SCOPe Domain Sequences for d5ucwb_:

Sequence, based on SEQRES records: (download)

>d5ucwb_ a.104.1.1 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdflgdglatswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievsedmtrltldtiglcgfnyrfnsfyrdqphpfiismvra
ldevmnklqranpddpaydenkrqfqedikvmndlvdkiiadrkargeqsddlltqmlng
kdpetgeplddgniryqiitfllaghegtsgllsfalyflvknphvlqkvaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptvpafslyakedtvlggeyplekgdevmvlipql
hrdktvwgddveefrperfenpsaipqhafkpfgngqrasigqqfalheatlvlgmmlkh
fdfedhtnyeldiketlslkpkgfvvkakskkiplggi

Sequence, based on observed residues (ATOM records): (download)

>d5ucwb_ a.104.1.1 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdflgdglatswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievsedmtrltldtiglcgfnyrfnsfyrdqphpfiismvra
ldevmnklqranpddpaydenkrqfqedikvmndlvdkiiadrkaddlltqmlngkdpet
geplddgniryqiitfllaghegtsgllsfalyflvknphvlqkvaeeaarvlvdpvpsy
kqvkqlkyvgmvlnealrlwptvpafslyakedtvlggeyplekgdevmvlipqlhrdkt
vwgddveefrperfenpsaipqhafkpfgngqrasigqqfalheatlvlgmmlkhfdfed
htnyeldiketlslkpkgfvvkakskkiplggi

SCOPe Domain Coordinates for d5ucwb_:

Click to download the PDB-style file with coordinates for d5ucwb_.
(The format of our PDB-style files is described here.)

Timeline for d5ucwb_: