Lineage for d5tp0a_ (5tp0 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065448Protein Trypsin(ogen) [50515] (9 species)
  7. 2065930Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (12 PDB entries)
  8. 2065936Domain d5tp0a_: 5tp0 A: [334269]
    automated match to d3p95a_
    complexed with brn, ca, so4

Details for d5tp0a_

PDB Entry: 5tp0 (more details), 1.25 Å

PDB Description: human mesotrypsin in complex with diminazene
PDB Compounds: (A:) Trypsin-3

SCOPe Domain Sequences for d5tp0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tp0a_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdsggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

SCOPe Domain Coordinates for d5tp0a_:

Click to download the PDB-style file with coordinates for d5tp0a_.
(The format of our PDB-style files is described here.)

Timeline for d5tp0a_: