Lineage for d5t30b2 (5t30 B:84-198)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946129Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2946193Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)
  8. 2946225Domain d5t30b2: 5t30 B:84-198 [334268]
    Other proteins in same PDB: d5t30a1, d5t30a3, d5t30b1, d5t30b3
    automated match to d1n0ja2
    complexed with azi, k, mn, po4

Details for d5t30b2

PDB Entry: 5t30 (more details), 1.77 Å

PDB Description: human mnsod-azide complex
PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d5t30b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t30b2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d5t30b2:

Click to download the PDB-style file with coordinates for d5t30b2.
(The format of our PDB-style files is described here.)

Timeline for d5t30b2: