SCOPe 2.06: Domain d5u8ca_: 5u8c A:

Lineage for d5u8ca_ (5u8c A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (27 PDB entries)

8. Domain d5u8ca_: 5u8c A: [334266]
   Other proteins in same PDB: d5u8cb_
   automated match to d1pb7a_
   complexed with 84j, gly, gol

Details for d5u8ca_

PDB Entry: 5u8c, 1.6 Å

PDB Description: crystal structure of glun1/glun2a ligand-binding domain in complex with glycine and nvp-aam077

PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5u8ca_:

Sequence, based on SEQRES records:

>d5u8ca_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mstrlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmi
vapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssv
diyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvtt
gelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqecd

Sequence, based on observed residues (ATOM records):

>d5u8ca_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mstrlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndrhtvpqccygfc
idlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivaplti
nneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrr
qvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffr
sgfgigmrkdspwkqnvslsilkshengfmedldktwvryqecd

Timeline for d5u8ca_:

• d5u8ca_ is new in SCOPe 2.06-stable
  
• d5u8ca_ appears in SCOPe 2.07
  
• d5u8ca_ appears in the current release, SCOPe 2.08