Lineage for d5ky4b_ (5ky4 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031827Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 3031828Protein automated matches [226968] (5 species)
    not a true protein
  7. 3031884Species Mouse (Mus musculus) [TaxId:10090] [334104] (4 PDB entries)
  8. 3031885Domain d5ky4b_: 5ky4 B: [334262]
    automated match to d1edmb_
    complexed with gdp, nag, pgo

Details for d5ky4b_

PDB Entry: 5ky4 (more details), 1.47 Å

PDB Description: mouse pofut1 in complex with mouse notch1 egf26 and gdp
PDB Compounds: (B:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d5ky4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ky4b_ g.3.11.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ctesscfnggtcvdginsftclcppgftgsycqydv

SCOPe Domain Coordinates for d5ky4b_:

Click to download the PDB-style file with coordinates for d5ky4b_.
(The format of our PDB-style files is described here.)

Timeline for d5ky4b_: