Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [334104] (4 PDB entries) |
Domain d5ky4b_: 5ky4 B: [334262] automated match to d1edmb_ complexed with gdp, nag, pgo |
PDB Entry: 5ky4 (more details), 1.47 Å
SCOPe Domain Sequences for d5ky4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ky4b_ g.3.11.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ctesscfnggtcvdginsftclcppgftgsycqydv
Timeline for d5ky4b_: