Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries) |
Domain d5t30a2: 5t30 A:84-198 [334261] Other proteins in same PDB: d5t30a1, d5t30a3, d5t30b1, d5t30b3 automated match to d1n0ja2 complexed with azi, k, mn, po4 |
PDB Entry: 5t30 (more details), 1.77 Å
SCOPe Domain Sequences for d5t30a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t30a2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk
Timeline for d5t30a2: