Lineage for d5t30a1 (5t30 A:0-83)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2302754Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303043Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303044Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 protein domains)
  6. 2303170Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 2303234Species Human (Homo sapiens) [TaxId:9606] [46619] (31 PDB entries)
  8. 2303265Domain d5t30a1: 5t30 A:0-83 [334260]
    Other proteins in same PDB: d5t30a2, d5t30b2
    automated match to d1n0ja1
    complexed with azi, k, mn, po4

Details for d5t30a1

PDB Entry: 5t30 (more details), 1.77 Å

PDB Description: human mnsod-azide complex
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d5t30a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t30a1 a.2.11.1 (A:0-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
mkhslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqia
lqpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d5t30a1:

Click to download the PDB-style file with coordinates for d5t30a1.
(The format of our PDB-style files is described here.)

Timeline for d5t30a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5t30a2