SCOPe 2.05: Domain d1hjoa2: 1hjo A:189-382

Lineage for d1hjoa2 (1hjo A:189-382)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53071] (4 PDB entries)

8. Domain d1hjoa2: 1hjo A:189-382 [33426]
   complexed with adp, ca, cl

Details for d1hjoa2

PDB Entry: 1hjo, 2.3 Å

PDB Description: ATPase domain of human heat shock 70kDa protein 1

PDB Compounds: (A:) protein (heat-shock 70kd protein)

SCOPe Domain Sequences for d1hjoa2:

Sequence; same for both SEQRES and ATOM records:

>d1hjoa2 c.55.1.1 (A:189-382) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]}
gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk
hkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsd
lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea
vaygaavqaailmg

Timeline for d1hjoa2:

• d1hjoa2 first appeared (with stable ids) in SCOP 1.55
  
• d1hjoa2 appears in SCOPe 2.04
  
• d1hjoa2 appears in SCOPe 2.06
  
• d1hjoa2 appears in the current release, SCOPe 2.08