SCOP 1.75: Domain d1hjoa1: 1hjo A:3-188

Lineage for d1hjoa1 (1hjo A:3-188)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53071] (6 PDB entries)

8. Domain d1hjoa1: 1hjo A:3-188 [33425]

Details for d1hjoa1

PDB Entry: 1hjo, 2.3 Å

PDB Description: ATPase domain of human heat shock 70kDa protein 1

PDB Compounds: (A:) protein (heat-shock 70kd protein)

SCOP Domain Sequences for d1hjoa1:

Sequence; same for both SEQRES and ATOM records:

>d1hjoa1 c.55.1.1 (A:3-188) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]}
kaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvaln
pqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissm
vltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaia
ygldrt

Timeline for d1hjoa1:

• d1hjoa1 first appeared (with stable ids) in SCOP 1.55
  
• d1hjoa1 appears in SCOP 1.73
  
• d1hjoa1 appears in SCOPe 2.01
  
• d1hjoa1 appears in the current release, SCOPe 2.08