Lineage for d5n1xb_ (5n1x B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945445Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 2945446Species Human (Homo sapiens) [TaxId:9606] [102923] (37 PDB entries)
  8. 2945469Domain d5n1xb_: 5n1x B: [334247]
    Other proteins in same PDB: d5n1xa2, d5n1xd2
    automated match to d1r29a_
    complexed with 8hh
    has additional insertions and/or extensions that are not grouped together

Details for d5n1xb_

PDB Entry: 5n1x (more details), 1.72 Å

PDB Description: crystal structure of the bcl6 btb domain in complex with pyrazolo- pyrimidine ligand
PDB Compounds: (B:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d5n1xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n1xb_ d.42.1.1 (B:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtarkfik
a

SCOPe Domain Coordinates for d5n1xb_:

Click to download the PDB-style file with coordinates for d5n1xb_.
(The format of our PDB-style files is described here.)

Timeline for d5n1xb_: