Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102923] (37 PDB entries) |
Domain d5n1xb_: 5n1x B: [334247] Other proteins in same PDB: d5n1xa2, d5n1xd2 automated match to d1r29a_ complexed with 8hh has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5n1x (more details), 1.72 Å
SCOPe Domain Sequences for d5n1xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n1xb_ d.42.1.1 (B:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtarkfik a
Timeline for d5n1xb_: