Lineage for d5h5xk_ (5h5x K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848668Species Streptomyces coelicolor [TaxId:100226] [187919] (2 PDB entries)
  8. 2848681Domain d5h5xk_: 5h5x K: [334243]
    automated match to d4g81a_
    complexed with ipa, mg, nai

Details for d5h5xk_

PDB Entry: 5h5x (more details), 2.3 Å

PDB Description: crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
PDB Compounds: (K:) Putative oxidoreductase

SCOPe Domain Sequences for d5h5xk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h5xk_ c.2.1.0 (K:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
tpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelrag
gveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvr
tnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaa
eyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivfllsdra
sfvagsyhlvdgaytav

SCOPe Domain Coordinates for d5h5xk_:

Click to download the PDB-style file with coordinates for d5h5xk_.
(The format of our PDB-style files is described here.)

Timeline for d5h5xk_: