Lineage for d5n55a_ (5n55 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996879Species Klebsiella pneumoniae [TaxId:573] [271524] (9 PDB entries)
  8. 2996889Domain d5n55a_: 5n55 A: [334230]
    automated match to d5a87b_
    complexed with 8nn, zn

Details for d5n55a_

PDB Entry: 5n55 (more details), 1.99 Å

PDB Description: mono-zinc vim-5 metallo-beta-lactamase in complex with (1-chloro-4- hydroxyisoquinoline-3-carbonyl)-l-tryptophan (compound 2)
PDB Compounds: (A:) Class B metallo-beta-lactamase

SCOPe Domain Sequences for d5n55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n55a_ d.157.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlrkagvatyaspstrrlaeaegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggxavlalsrtsagnv
adadlaewptsveriqkhypeaevvipghglpggldllqhtanvvtahkn

SCOPe Domain Coordinates for d5n55a_:

Click to download the PDB-style file with coordinates for d5n55a_.
(The format of our PDB-style files is described here.)

Timeline for d5n55a_: