SCOPe 2.06: Domain d1atsa1: 1ats A:2-188

Lineage for d1atsa1 (1ats A:2-188)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)

8. Domain d1atsa1: 1ats A:2-188 [33423]
   complexed with adp, mg

Details for d1atsa1

PDB Entry: 1ats, 2.43 Å

PDB Description: threonine 204 of the chaperone protein hsc70 influences the structure of the active site but is not essential for atp hydrolysis

PDB Compounds: (A:) heat-shock cognate 70 kd protein

SCOPe Domain Sequences for d1atsa1:

Sequence; same for both SEQRES and ATOM records:

>d1atsa1 c.55.1.1 (A:2-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
skgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvam
nptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevss
mvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaai
aygldkk

Timeline for d1atsa1:

• d1atsa1 first appeared (with stable ids) in SCOP 1.55, called d1ats_1
  
• d1atsa1 appears in SCOPe 2.05
  
• d1atsa1 appears in SCOPe 2.07
  
• d1atsa1 appears in the current release, SCOPe 2.08