Lineage for d1ats_1 (1ats 2-188)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586265Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) (S)
    duplication contains two domains of this fold
  5. 586266Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 586365Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 586366Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)
  8. 586413Domain d1ats_1: 1ats 2-188 [33423]

Details for d1ats_1

PDB Entry: 1ats (more details), 2.43 Å

PDB Description: threonine 204 of the chaperone protein hsc70 influences the structure of the active site but is not essential for atp hydrolysis

SCOP Domain Sequences for d1ats_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ats_1 c.55.1.1 (2-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
skgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvam
nptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevss
mvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaai
aygldkk

SCOP Domain Coordinates for d1ats_1:

Click to download the PDB-style file with coordinates for d1ats_1.
(The format of our PDB-style files is described here.)

Timeline for d1ats_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ats_2