| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
| Protein automated matches [191162] (29 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries) |
| Domain d2nd5a1: 2nd5 A:0-107 [334228] Other proteins in same PDB: d2nd5a2 automated match to d4c02b_ |
PDB Entry: 2nd5 (more details)
SCOPe Domain Sequences for d2nd5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nd5a1 d.26.1.0 (A:0-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgw
eegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
Timeline for d2nd5a1: