SCOPe 2.08: Domain d2nd5a1: 2nd5 A:0-107

Lineage for d2nd5a1 (2nd5 A:0-107)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)

8. Domain d2nd5a1: 2nd5 A:0-107 [334228]
   Other proteins in same PDB: d2nd5a2
   automated match to d4c02b_

Details for d2nd5a1

PDB Entry: 2nd5

PDB Description: lysine dimethylated fkbp12

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d2nd5a1:

Sequence; same for both SEQRES and ATOM records:

>d2nd5a1 d.26.1.0 (A:0-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgw
eegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d2nd5a1:

• d2nd5a1 first appeared in SCOPe 2.06
  
• d2nd5a1 appears in SCOPe 2.07