Lineage for d5j7fb_ (5j7f B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998383Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1998384Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1998385Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 1998392Protein MDM2 [47594] (2 species)
  7. 1998410Species Human (Homo sapiens) [TaxId:9606] [47596] (59 PDB entries)
  8. 1998497Domain d5j7fb_: 5j7f B: [334222]
    automated match to d2lzga_
    complexed with 6gg

Details for d5j7fb_

PDB Entry: 5j7f (more details), 2 Å

PDB Description: structure of mdm2 with low molecular weight inhibitor with aliphatic linker.
PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5j7fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j7fb_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
gavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekq
qhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqe

SCOPe Domain Coordinates for d5j7fb_:

Click to download the PDB-style file with coordinates for d5j7fb_.
(The format of our PDB-style files is described here.)

Timeline for d5j7fb_: