Lineage for d5mima2 (5mim A:443-574)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775243Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)
  8. 2775261Domain d5mima2: 5mim A:443-574 [334210]
    Other proteins in same PDB: d5mima1, d5mima3
    automated match to d1p8ja1
    complexed with 1n, ca, cl, na

Details for d5mima2

PDB Entry: 5mim (more details), 1.9 Å

PDB Description: xray structure of human furin bound with the 2,5-dideoxystreptamine derived small molecule inhibitor 1n
PDB Compounds: (A:) Furin

SCOPe Domain Sequences for d5mima2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mima2 b.18.1.0 (A:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla
ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt
ltkftlvlygta

SCOPe Domain Coordinates for d5mima2:

Click to download the PDB-style file with coordinates for d5mima2.
(The format of our PDB-style files is described here.)

Timeline for d5mima2: