SCOP 1.71: Domain d1atr_1: 1atr 2-188

Lineage for d1atr_1 (1atr 2-188)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)

8. Domain d1atr_1: 1atr 2-188 [33421]

Details for d1atr_1

PDB Entry: 1atr, 2.34 Å

PDB Description: threonine 204 of the chaperone protein hsc70 influences the structure of the active site but is not essential for atp hydrolysis

SCOP Domain Sequences for d1atr_1:

Sequence; same for both SEQRES and ATOM records:

>d1atr_1 c.55.1.1 (2-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
skgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvam
nptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevss
mvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaai
aygldkk

Timeline for d1atr_1:

• d1atr_1 first appeared (with stable ids) in SCOP 1.55
  
• d1atr_1 appears in SCOP 1.69
  
• d1atr_1 is called d1atra1 in SCOP 1.73
  
• d1atr_1 appears in the current release, SCOPe 2.08, called d1atra1