![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) automatically mapped to Pfam PF00754 |
![]() | Protein B1 domain of neuropilin-1 [82016] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82017] (9 PDB entries) |
![]() | Domain d5jgia1: 5jgi A:273-427 [334203] Other proteins in same PDB: d5jgia2 automated match to d1kexa_ complexed with aag |
PDB Entry: 5jgi (more details), 1.38 Å
SCOPe Domain Sequences for d5jgia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jgia1 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]} fkcmealgmesgeihsdqitassqystnwsaersrlnypengwtpgedsyrewiqvdlgl lrfvtavgtqgaisketkkkyyvktykidvssngedwitikegnkpvlfqgntnptdvvv avfpkplitrfvrikpatwetgismrfevygckit
Timeline for d5jgia1: