SCOPe 2.05: Domain d1ngia2: 1ngi A:189-381

Lineage for d1ngia2 (1ngi A:189-381)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)

8. Domain d1ngia2: 1ngi A:189-381 [33420]
   complexed with anp, ca; mutant

Details for d1ngia2

PDB Entry: 1ngi, 2.15 Å

PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment

PDB Compounds: (A:) heat-shock cognate 70 kd protein

SCOPe Domain Sequences for d1ngia2:

Sequence; same for both SEQRES and ATOM records:

>d1ngia2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

Timeline for d1ngia2:

• d1ngia2 first appeared (with stable ids) in SCOP 1.55, called d1ngi_2
  
• d1ngia2 appears in SCOPe 2.04
  
• d1ngia2 appears in SCOPe 2.06
  
• d1ngia2 appears in the current release, SCOPe 2.08