![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Thermoplasma acidophilum [TaxId:273075] [334133] (1 PDB entry) |
![]() | Domain d5j77a_: 5j77 A: [334198] automated match to d4pz2a_ mutant |
PDB Entry: 5j77 (more details), 2.1 Å
SCOPe Domain Sequences for d5j77a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j77a_ c.82.1.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 273075]} mdtklyidgqwvnsssgktvdkyspvtgqvigrmeaatrddvdraidaaedafwawndlg sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng yfflptiignadqkskifqeeifapvigarkissveemydlandnkyglasylftkdpni ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk plhintvrddlf
Timeline for d5j77a_: