SCOPe 2.06: Domain d5jtfa_: 5jtf A:

Lineage for d5jtfa_ (5jtf A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [334147] (1 PDB entry)

8. Domain d5jtfa_: 5jtf A: [334197]
   automated match to d3dr8b_
   complexed with trs

Details for d5jtfa_

PDB Entry: 5jtf, 2.16 Å

PDB Description: crystal structure of arsn n-acetyltransferase from pseudomonas putida kt2440

PDB Compounds: (A:) putative phosphinothricin n-acetyltransferase

SCOPe Domain Sequences for d5jtfa_:

Sequence; same for both SEQRES and ATOM records:

>d5jtfa_ d.108.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfl

Timeline for d5jtfa_:

• d5jtfa_ is new in SCOPe 2.06-stable
  
• d5jtfa_ appears in SCOPe 2.07
  
• d5jtfa_ appears in the current release, SCOPe 2.08