| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Pseudomonas putida [TaxId:160488] [334147] (3 PDB entries) |
| Domain d5jtfa_: 5jtf A: [334197] automated match to d3dr8b_ complexed with trs |
PDB Entry: 5jtf (more details), 2.16 Å
SCOPe Domain Sequences for d5jtfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jtfa_ d.108.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfl
Timeline for d5jtfa_: