Lineage for d5m6xa_ (5m6x A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332578Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2332579Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2332580Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 protein domains)
    Pfam PF00620
  6. 2332603Protein automated matches [334155] (2 species)
    not a true protein
  7. 2332604Species Human (Homo sapiens) [TaxId:9606] [334156] (2 PDB entries)
  8. 2332607Domain d5m6xa_: 5m6x A: [334195]
    Other proteins in same PDB: d5m6xb_, d5m6xi_
    automated match to d1grnb_
    complexed with gdp, mg, mgf

Details for d5m6xa_

PDB Entry: 5m6x (more details), 2.4 Å

PDB Description: crystal structure of human rhogap mutated in its arginine finger (r85a) in complex with rhoa.gdp.mgf3- human
PDB Compounds: (A:) Rho GTPase-activating protein 1

SCOPe Domain Sequences for d5m6xa_:

Sequence, based on SEQRES records: (download)

>d5m6xa_ a.116.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqfgvslqhlqeknpeqepipivlretvaylqahalttegifarsantqvvrevqqkynm
glpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqvlqt
lpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpintf
tkflldhqgelf

Sequence, based on observed residues (ATOM records): (download)

>d5m6xa_ a.116.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqfgvslqhlqeknpipivlretvaylqahalttegifarsantqvvrevqqkynmglpv
dfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqvlqtlpee
nyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpintftkfl
ldhqgelf

SCOPe Domain Coordinates for d5m6xa_:

Click to download the PDB-style file with coordinates for d5m6xa_.
(The format of our PDB-style files is described here.)

Timeline for d5m6xa_: