Lineage for d5gm5f_ (5gm5 F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2051981Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (6 PDB entries)
  8. 2051992Domain d5gm5f_: 5gm5 F: [334191]
    automated match to d3vl9b_
    complexed with cbi, epe, so4

Details for d5gm5f_

PDB Entry: 5gm5 (more details), 1.73 Å

PDB Description: crystal structure of fi-cmcase from aspergillus aculeatus f-50 in complex with cellobiose
PDB Compounds: (F:) Endoglucanase-1

SCOPe Domain Sequences for d5gm5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gm5f_ b.29.1.0 (F:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
nhgfpassqylitlqfgtapftggpatlsvsnwsasvq

SCOPe Domain Coordinates for d5gm5f_:

Click to download the PDB-style file with coordinates for d5gm5f_.
(The format of our PDB-style files is described here.)

Timeline for d5gm5f_: