| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (6 PDB entries) |
| Domain d5gm5f_: 5gm5 F: [334191] automated match to d3vl9b_ complexed with epe, so4 |
PDB Entry: 5gm5 (more details), 1.73 Å
SCOPe Domain Sequences for d5gm5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gm5f_ b.29.1.0 (F:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
nhgfpassqylitlqfgtapftggpatlsvsnwsasvq
Timeline for d5gm5f_: