Lineage for d5jx6b_ (5jx6 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458768Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2458769Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2458837Family c.6.1.0: automated matches [195757] (1 protein)
    not a true family
  6. 2458838Protein automated matches [195758] (2 species)
    not a true protein
  7. 2458849Species Orpinomyces sp. [TaxId:884017] [334100] (3 PDB entries)
  8. 2458855Domain d5jx6b_: 5jx6 B: [334184]
    automated match to d4a05a_
    complexed with cbi, edo, gol, mpd, nh4, po4

Details for d5jx6b_

PDB Entry: 5jx6 (more details), 2.21 Å

PDB Description: gh6 orpinomyces sp. y102 enzyme
PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d5jx6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jx6b_ c.6.1.0 (B:) automated matches {Orpinomyces sp. [TaxId: 884017]}
tsdnffenelysnykfqgevdqsiqrlsgslqekakkvkyvptaawlawsgatnevaryl
neagsktvvfvlymiptrdcnaggsnggadnlstyqgyvnsiyntinqypnsrivmiiep
dtignlvtannancrnvhdmhkqalsyaiskfgtqknvrvyldaahggwlnssadrtaev
iaeilrnagngkirgistnvsnyqpvyseyqyhqnlnralesrgvrgmkfivdtsrngrn
pssatwcnlkgaglgarpqanpdpnmplldayvwiktpgesdsassadpvcrnsdslqga
paagswfhdyfvmllenanppf

SCOPe Domain Coordinates for d5jx6b_:

Click to download the PDB-style file with coordinates for d5jx6b_.
(The format of our PDB-style files is described here.)

Timeline for d5jx6b_: