Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries) |
Domain d3mg4r_: 3mg4 R: [334180] Other proteins in same PDB: d3mg41_, d3mg42_, d3mg4a_, d3mg4b_, d3mg4c_, d3mg4e_, d3mg4f_, d3mg4g_, d3mg4h_, d3mg4i_, d3mg4j_, d3mg4k_, d3mg4l_, d3mg4m_, d3mg4n_, d3mg4o_, d3mg4p_, d3mg4q_, d3mg4s_, d3mg4t_, d3mg4u_, d3mg4v_, d3mg4w_, d3mg4x_, d3mg4y_, d3mg4z_ automated match to d1iruf_ complexed with lxt, mes, mg |
PDB Entry: 3mg4 (more details), 3.11 Å
SCOPe Domain Sequences for d3mg4r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mg4r_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea ae
Timeline for d3mg4r_:
View in 3D Domains from other chains: (mouse over for more information) d3mg41_, d3mg42_, d3mg4a_, d3mg4b_, d3mg4c_, d3mg4d_, d3mg4e_, d3mg4f_, d3mg4g_, d3mg4h_, d3mg4i_, d3mg4j_, d3mg4k_, d3mg4l_, d3mg4m_, d3mg4n_, d3mg4o_, d3mg4p_, d3mg4q_, d3mg4s_, d3mg4t_, d3mg4u_, d3mg4v_, d3mg4w_, d3mg4x_, d3mg4y_, d3mg4z_ |