Lineage for d1ngd_2 (1ngd 189-381)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) 
Family c.55.1.1: Actin/HSP70 [53068] (4 proteins) 
Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries) 
Domain d1ngd_2: 1ngd 189-381 [33418]
Details for d1ngd_2
PDB Entry: 1ngd (more details), 2.44 Å
PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment
SCOP Domain Sequences for d1ngd_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngd_2 c.55.1.1 (189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggtfnvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails
SCOP Domain Coordinates for d1ngd_2:
Click to download the PDB-style file with coordinates for d1ngd_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ngd_2:
- d1ngd_2 first appeared (with stable ids) in SCOP 1.55
- d1ngd_2 appears in SCOP 1.59
- d1ngd_2 appears in the current release, SCOPe 2.08, called d1ngda2
View in 3D
