SCOPe 2.07: Domain d5j7ga1: 5j7g A:18-110

Lineage for d5j7ga1 (5j7g A:18-110)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (69 PDB entries)

8. Domain d5j7ga1: 5j7g A:18-110 [334178]
   Other proteins in same PDB: d5j7ga2
   automated match to d1ttva_
   complexed with 6gg

Details for d5j7ga1

PDB Entry: 5j7g, 1.85 Å

PDB Description: structure of mdm2 with low molecular weight inhibitor with aliphatic linker.

PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5j7ga1:

Sequence; same for both SEQRES and ATOM records:

>d5j7ga1 a.42.1.1 (A:18-110) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Timeline for d5j7ga1:

• d5j7ga1 first appeared in SCOPe 2.06