![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein automated matches [190092] (2 species) not a true protein |
![]() | Species Mus musculus [TaxId:10090] [334131] (3 PDB entries) |
![]() | Domain d5ky2b_: 5ky2 B: [334174] automated match to d1f7ea_ complexed with bgc, gdp, gol, nag |
PDB Entry: 5ky2 (more details), 1.47 Å
SCOPe Domain Sequences for d5ky2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ky2b_ g.3.11.1 (B:) automated matches {Mus musculus [TaxId: 10090]} dgdqcasnpcqnggtcqdhlksyvcfclldfegrnceksk
Timeline for d5ky2b_: