Lineage for d5ky2b_ (5ky2 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031664Protein automated matches [190092] (2 species)
    not a true protein
  7. 3031749Species Mouse (Mus musculus) [TaxId:10090] [334131] (3 PDB entries)
  8. 3031751Domain d5ky2b_: 5ky2 B: [334174]
    automated match to d1f7ea_
    complexed with bgc, gdp, gol, nag

Details for d5ky2b_

PDB Entry: 5ky2 (more details), 1.47 Å

PDB Description: mouse pofut1 in complex with o-glucosylated mouse factor vii egf1 and gdp
PDB Compounds: (B:) Coagulation factor VII

SCOPe Domain Sequences for d5ky2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ky2b_ g.3.11.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dgdqcasnpcqnggtcqdhlksyvcfclldfegrnceksk

SCOPe Domain Coordinates for d5ky2b_:

Click to download the PDB-style file with coordinates for d5ky2b_.
(The format of our PDB-style files is described here.)

Timeline for d5ky2b_: