Class a: All alpha proteins [46456] (289 folds) |
Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) |
Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins) Pfam PF00620 |
Protein automated matches [334155] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [334156] (3 PDB entries) |
Domain d5m70a_: 5m70 A: [334170] Other proteins in same PDB: d5m70b_, d5m70g_ automated match to d1grnb_ complexed with alf, gdp, mg |
PDB Entry: 5m70 (more details), 2.2 Å
SCOPe Domain Sequences for d5m70a_:
Sequence, based on SEQRES records: (download)
>d5m70a_ a.116.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qqfgvslqhlqeknpeqepipivlretvaylqahalttegifarsantqvvrevqqkynm glpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqvlqt lpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpintf tkflldhqgelf
>d5m70a_ a.116.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qqfgvslqhlqeknpipivlretvaylqahalttegifarsantqvvrevqqkynmglpv dfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqvlqtlpee nyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpintftkfl ldhqgelf
Timeline for d5m70a_: