Lineage for d5gm3b_ (5gm3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780849Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (6 PDB entries)
  8. 2780861Domain d5gm3b_: 5gm3 B: [334166]
    automated match to d3vl9a_
    complexed with cac, zn

Details for d5gm3b_

PDB Entry: 5gm3 (more details), 1.59 Å

PDB Description: crystal structure of fi-cmcase from aspergillus aculeatus f-50
PDB Compounds: (B:) Endoglucanase-1

SCOPe Domain Sequences for d5gm3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gm3b_ b.29.1.0 (B:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
nhgfpassqylitlqfgtepftggpatlsvsnwsasvq

SCOPe Domain Coordinates for d5gm3b_:

Click to download the PDB-style file with coordinates for d5gm3b_.
(The format of our PDB-style files is described here.)

Timeline for d5gm3b_: