SCOPe 2.08: Domain d5gm3a_: 5gm3 A:

Lineage for d5gm3a_ (5gm3 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (6 PDB entries)

8. Domain d5gm3a_: 5gm3 A: [334152]
   automated match to d3vl9a_
   complexed with cac, zn

Details for d5gm3a_

PDB Entry: 5gm3, 1.59 Å

PDB Description: crystal structure of fi-cmcase from aspergillus aculeatus f-50

PDB Compounds: (A:) Endoglucanase-1

SCOPe Domain Sequences for d5gm3a_:

Sequence; same for both SEQRES and ATOM records:

>d5gm3a_ b.29.1.0 (A:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
qnhgfpassqylitlqfgtepftggpatlsvsnwsasvq

Timeline for d5gm3a_:

• d5gm3a_ first appeared in SCOPe 2.06
  
• d5gm3a_ appears in SCOPe 2.07