Lineage for d5h3ga1 (5h3g A:1-91)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697427Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 2697448Family a.11.1.0: automated matches [191596] (1 protein)
    not a true family
  6. 2697449Protein automated matches [191086] (6 species)
    not a true protein
  7. 2697467Species Oryza sativa [TaxId:39947] [334150] (1 PDB entry)
  8. 2697468Domain d5h3ga1: 5h3g A:1-91 [334151]
    Other proteins in same PDB: d5h3ga2
    automated match to d3epya_
    complexed with cl, gol

Details for d5h3ga1

PDB Entry: 5h3g (more details), 1.6 Å

PDB Description: crystal structure of oryza sativa acyl-coa-binding protein 1
PDB Compounds: (A:) Putative Acyl-CoA binding protein (ACBP)

SCOPe Domain Sequences for d5h3ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h3ga1 a.11.1.0 (A:1-91) automated matches {Oryza sativa [TaxId: 39947]}
mglqedfeqyaekaktlpestsnenklilyglykqatvgdvntarpgifaqrdrakwdaw
kavegkskeeamsdyitkvkqlleeaaaaas

SCOPe Domain Coordinates for d5h3ga1:

Click to download the PDB-style file with coordinates for d5h3ga1.
(The format of our PDB-style files is described here.)

Timeline for d5h3ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5h3ga2