SCOPe 2.08: Domain d5h3ga1: 5h3g A:1-91

Lineage for d5h3ga1 (5h3g A:1-91)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families)

5. Family a.11.1.0: automated matches [191596] (1 protein)
   not a true family

6. Protein automated matches [191086] (6 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [334150] (1 PDB entry)

8. Domain d5h3ga1: 5h3g A:1-91 [334151]
   Other proteins in same PDB: d5h3ga2
   automated match to d3epya_
   complexed with cl, gol

Details for d5h3ga1

PDB Entry: 5h3g, 1.6 Å

PDB Description: crystal structure of oryza sativa acyl-coa-binding protein 1

PDB Compounds: (A:) Putative Acyl-CoA binding protein (ACBP)

SCOPe Domain Sequences for d5h3ga1:

Sequence; same for both SEQRES and ATOM records:

>d5h3ga1 a.11.1.0 (A:1-91) automated matches {Oryza sativa [TaxId: 39947]}
mglqedfeqyaekaktlpestsnenklilyglykqatvgdvntarpgifaqrdrakwdaw
kavegkskeeamsdyitkvkqlleeaaaaas

Timeline for d5h3ga1:

• d5h3ga1 first appeared in SCOPe 2.06
  
• d5h3ga1 appears in SCOPe 2.07