![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) ![]() |
![]() | Family a.11.1.0: automated matches [191596] (1 protein) not a true family |
![]() | Protein automated matches [191086] (6 species) not a true protein |
![]() | Species Oryza sativa [TaxId:39947] [334150] (1 PDB entry) |
![]() | Domain d5h3ga1: 5h3g A:1-91 [334151] Other proteins in same PDB: d5h3ga2 automated match to d3epya_ complexed with cl, gol |
PDB Entry: 5h3g (more details), 1.6 Å
SCOPe Domain Sequences for d5h3ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h3ga1 a.11.1.0 (A:1-91) automated matches {Oryza sativa [TaxId: 39947]} mglqedfeqyaekaktlpestsnenklilyglykqatvgdvntarpgifaqrdrakwdaw kavegkskeeamsdyitkvkqlleeaaaaas
Timeline for d5h3ga1: