Lineage for d5ky8b_ (5ky8 B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2583282Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2583283Protein automated matches [226968] (4 species)
    not a true protein
  7. 2583337Species Mouse (Mus musculus) [TaxId:10090] [334104] (4 PDB entries)
  8. 2583340Domain d5ky8b_: 5ky8 B: [334149]
    automated match to d1f7ea_
    complexed with bgc, gdp, nag; mutant

Details for d5ky8b_

PDB Entry: 5ky8 (more details), 1.65 Å

PDB Description: mouse pofut1 in complex with o-glucosylated mouse notch1 egf12 mutant (d464g) and gdp
PDB Compounds: (B:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d5ky8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ky8b_ g.3.11.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnecisnpcqngatcldqigefqcicmpgyegvyceint

SCOPe Domain Coordinates for d5ky8b_:

Click to download the PDB-style file with coordinates for d5ky8b_.
(The format of our PDB-style files is described here.)

Timeline for d5ky8b_: