![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
![]() | Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries) |
![]() | Domain d1ngh_2: 1ngh 189-381 [33414] complexed with atp; mutant |
PDB Entry: 1ngh (more details), 2.5 Å
SCOP Domain Sequences for d1ngh_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngh_2 c.55.1.1 (189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)} vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea vaygaavqaails
Timeline for d1ngh_2: