![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein automated matches [190092] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [334131] (3 PDB entries) |
![]() | Domain d5ky3b_: 5ky3 B: [334132] automated match to d1f7ea_ complexed with gfb, gol, nag; mutant |
PDB Entry: 5ky3 (more details), 1.53 Å
SCOPe Domain Sequences for d5ky3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ky3b_ g.3.11.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qcasnpcqnggacqdhlksyvcfclldfegrnceksk
Timeline for d5ky3b_: