Lineage for d1ngh_1 (1ngh 4-188)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316625Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 316626Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 316697Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 316698Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)
  8. 316739Domain d1ngh_1: 1ngh 4-188 [33413]

Details for d1ngh_1

PDB Entry: 1ngh (more details), 2.5 Å

PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment

SCOP Domain Sequences for d1ngh_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngh_1 c.55.1.1 (4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
gpavginlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk

SCOP Domain Coordinates for d1ngh_1:

Click to download the PDB-style file with coordinates for d1ngh_1.
(The format of our PDB-style files is described here.)

Timeline for d1ngh_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngh_2