| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
| Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species) protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
| Species Escherichia coli [TaxId:83333] [419302] (26 PDB entries) |
| Domain d5jcra_: 5jcr A: [334129] automated match to d4csta_ complexed with mma |
PDB Entry: 5jcr (more details), 1.7 Å
SCOPe Domain Sequences for d5jcra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jcra_ b.2.3.2 (A:) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d5jcra_: