Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (53 species) not a true protein |
Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (6 PDB entries) |
Domain d5gm4g_: 5gm4 G: [334126] automated match to d3vlbb_ complexed with ctt, so4 |
PDB Entry: 5gm4 (more details), 1.92 Å
SCOPe Domain Sequences for d5gm4g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gm4g_ b.29.1.0 (G:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]} qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq nhgfpassqylitlqfgtapftggpatlsvsnwsasvq
Timeline for d5gm4g_: