Lineage for d5jx5a_ (5jx5 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110411Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2110412Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2110481Family c.6.1.0: automated matches [195757] (1 protein)
    not a true family
  6. 2110482Protein automated matches [195758] (2 species)
    not a true protein
  7. 2110493Species Orpinomyces sp. [TaxId:884017] [334100] (2 PDB entries)
  8. 2110494Domain d5jx5a_: 5jx5 A: [334116]
    automated match to d4a05a_
    complexed with act, edo, gol, mpd, nh4, peg, po4

Details for d5jx5a_

PDB Entry: 5jx5 (more details), 1.8 Å

PDB Description: gh6 orpinomyces sp. y102 enzyme
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5jx5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jx5a_ c.6.1.0 (A:) automated matches {Orpinomyces sp. [TaxId: 884017]}
tsdnffenelysnykfqgevdqsiqrlsgslqekakkvkyvptaawlawsgatnevaryl
neagsktvvfvlymiptrdcnaggsnggadnlstyqgyvnsiyntinqypnsrivmiiep
dtignlvtannancrnvhdmhkqalsyaiskfgtqknvrvyldaahggwlnssadrtaev
iaeilrnagngkirgistnvsnyqpvyseyqyhqnlnralesrgvrgmkfivdtsrngrn
pssatwcnlkgaglgarpqanpdpnmplldayvwiktpgesdsassadpvcrnsdslqga
paagswfhdyfvmllenanppf

SCOPe Domain Coordinates for d5jx5a_:

Click to download the PDB-style file with coordinates for d5jx5a_.
(The format of our PDB-style files is described here.)

Timeline for d5jx5a_: