SCOP 1.57: Domain d1ngc_1: 1ngc 4-188

Lineage for d1ngc_1 (1ngc 4-188)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families)

5. Family c.55.1.1: Actin/HSP70 [53068] (4 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)

8. Domain d1ngc_1: 1ngc 4-188 [33411]

Details for d1ngc_1

PDB Entry: 1ngc, 2.48 Å

PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment

SCOP Domain Sequences for d1ngc_1:

Sequence; same for both SEQRES and ATOM records:

>d1ngc_1 c.55.1.1 (4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk

Timeline for d1ngc_1:

• d1ngc_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ngc_1 appears in SCOP 1.59
  
• d1ngc_1 appears in the current release, SCOPe 2.08, called d1ngca1