Lineage for d5ky0b_ (5ky0 B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2583282Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2583283Protein automated matches [226968] (4 species)
    not a true protein
  7. 2583337Species Mouse (Mus musculus) [TaxId:10090] [334104] (4 PDB entries)
  8. 2583339Domain d5ky0b_: 5ky0 B: [334105]
    automated match to d1f7ea_
    complexed with gdp, gol, nag

Details for d5ky0b_

PDB Entry: 5ky0 (more details), 1.53 Å

PDB Description: mouse pofut1 in complex with mouse notch1 egf12(d464g) and gdp
PDB Compounds: (B:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d5ky0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ky0b_ g.3.11.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
necisnpcqngatcldqigefqcicmpgyegvyceint

SCOPe Domain Coordinates for d5ky0b_:

Click to download the PDB-style file with coordinates for d5ky0b_.
(The format of our PDB-style files is described here.)

Timeline for d5ky0b_: