Lineage for d1nge_2 (1nge 189-381)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25008Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) (S)
  5. 25009Family c.55.1.1: Actin/HSP70 [53068] (3 protein domains)
  6. 25045Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 25046Species Cow (Bos taurus) [TaxId:9913] [53070] (24 PDB entries)
  8. 25076Domain d1nge_2: 1nge 189-381 [33410]

Details for d1nge_2

PDB Entry: 1nge (more details), 2.43 Å

PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment

SCOP Domain Sequences for d1nge_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nge_2 c.55.1.1 (189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifslgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

SCOP Domain Coordinates for d1nge_2:

Click to download the PDB-style file with coordinates for d1nge_2.
(The format of our PDB-style files is described here.)

Timeline for d1nge_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nge_1