Lineage for d5gnla_ (5gnl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2332063Species Pseudonocardia autotrophica [TaxId:2074] [189387] (8 PDB entries)
  8. 2332080Domain d5gnla_: 5gnl A: [334082]
    automated match to d3a51a_
    complexed with hem, pg0; mutant

Details for d5gnla_

PDB Entry: 5gnl (more details), 1.95 Å

PDB Description: cytochrome p450 vdh (cyp107br1) f106v mutant
PDB Compounds: (A:) Vitamin D(3) 25-hydroxylase

SCOPe Domain Sequences for d5gnla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gnla_ a.104.1.0 (A:) automated matches {Pseudonocardia autotrophica [TaxId: 2074]}
eqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvdprlskdwr
htlpedqradmpatptpmmilmdppdhtrlrklvgrsvtvrrmnelepriteiadgllag
lptdgpvdlmreyafqipvqvicellgvpaedrddfsawssvlvddspaddknaamgklh
gylsdllerkrtepddallssllavsdedgdrlsqeelvamamllliaghettvnligng
vlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgvtipagemv
mlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrvaigrlfadr
pelalavgldelvyrestlvrglsrmpvtmgprsa

SCOPe Domain Coordinates for d5gnla_:

Click to download the PDB-style file with coordinates for d5gnla_.
(The format of our PDB-style files is described here.)

Timeline for d5gnla_: