Lineage for d5j7gb_ (5j7g B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712372Protein MDM2 [47594] (2 species)
  7. 2712390Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)
  8. 2712470Domain d5j7gb_: 5j7g B: [334081]
    Other proteins in same PDB: d5j7ga2
    automated match to d1ttva_
    complexed with 6gg

Details for d5j7gb_

PDB Entry: 5j7g (more details), 1.85 Å

PDB Description: structure of mdm2 with low molecular weight inhibitor with aliphatic linker.
PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5j7gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j7gb_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqe

SCOPe Domain Coordinates for d5j7gb_:

Click to download the PDB-style file with coordinates for d5j7gb_.
(The format of our PDB-style files is described here.)

Timeline for d5j7gb_: