Lineage for d5gm5g_ (5gm5 G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780849Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (6 PDB entries)
  8. 2780859Domain d5gm5g_: 5gm5 G: [334072]
    automated match to d3vl9b_
    complexed with epe, so4

Details for d5gm5g_

PDB Entry: 5gm5 (more details), 1.73 Å

PDB Description: crystal structure of fi-cmcase from aspergillus aculeatus f-50 in complex with cellobiose
PDB Compounds: (G:) Endoglucanase-1

SCOPe Domain Sequences for d5gm5g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gm5g_ b.29.1.0 (G:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
qnhgfpassqylitlqfgtapftggpatlsvsnwsasvq

SCOPe Domain Coordinates for d5gm5g_:

Click to download the PDB-style file with coordinates for d5gm5g_.
(The format of our PDB-style files is described here.)

Timeline for d5gm5g_: